PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G321400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 314aa    MW: 34872.8 Da    PI: 5.8818
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G321400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.41.1e-38101091100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkC++dC+lapyfp +qpk f+n+hklFG+sn+lk+lk l +++r++am+s++++A++r + PvyG++gv+++l+ q +ql  
  Aqcoe3G321400.1.p  10 ACAACKYQRRKCSADCALAPYFPPDQPKMFQNAHKLFGVSNILKVLKGLLPHQRKEAMKSIIMHANIRDKFPVYGCFGVVKDLEYQFQQLCM 101
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        el+++ ++
  Aqcoe3G321400.1.p 102 ELDAVSAQ 109
                        **999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.1519110IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-3710106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MTVKGGTNQA CAACKYQRRK CSADCALAPY FPPDQPKMFQ NAHKLFGVSN ILKVLKGLLP  60
HQRKEAMKSI IMHANIRDKF PVYGCFGVVK DLEYQFQQLC MELDAVSAQL AICRQQYNHQ  120
FSPPSPNNSP SSKLQLGQAS PHNNSALPLF QHCVPQQQQS FNGTPGNGIS VFAPNQPAGL  180
SYGNNVCSYN ASDYVETKDA NGNSMWIQQQ HQPYNQNNNM NNNNYSASIQ SQFLAPEELP  240
IKQQTVDDDP QDYDEIPAFF DIIDDRQSYI DSKEAYESSS DSSLKDTTRS NIEQVSENEL  300
KSAAACFSLT SVN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255986.11e-108PREDICTED: LOB domain-containing protein 27-like
TrEMBLV4TMK41e-98V4TMK4_9R
STRINGPOPTR_0012s07390.17e-87(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.18e-43LOB domain-containing protein 27